SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029355 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029355
Domain Number 1 Region: 436-592
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-25
Family SPRY domain 0.011
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily RING/U-box 8.95e-17
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 178-229
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000011
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029355   Gene: ENSSSCG00000017199   Transcript: ENSSSCT00000036347
Sequence length 654
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:5492062:5496460:1 gene:ENSSSCG00000017199 transcript:ENSSSCT00000036347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGGWPFSCPICLEPLREPVTLPCGHNFCLACLSALWPHRGAGGAGGPGGTARCPLCQEP
FPDGLQLRKNHTLSELLQLRQGSGPGPGPGPAPTPAAALAPEPAAPSAPPSSPPSAPEPS
APSAPEPWPEGEEPVRCDACPEGAALPAALSCLSCLASFCPAHLGPHERSPALRGHRLVP
PLRRLEESLCPRHLRPLERYCRADRVCLCETCAAQEHRGHELVPLEQERALQEVGCGCHP
QAEQPKVLSAVEDRMDELGAGIAQSRRTVALIKSAAVAERERVSRLFAEAAAVLQRFQTE
VLGFIDEGEATMLGHSQGDLRRQEDQRSRLSQARHNLSQVPEADSVSFLQELLALRLALE
EGCGPGPAPPRELSFTKSSQAVRKVRDVLASACTSQWEQLQGLGSDEDGLQKPGTEAETE
TQDPDSTNSLESEAPRDYFLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPESPTR
FTHCEQVLGEGALDRGTYYWEVEIIEGWVSVGVMAEDFSPLEPYDRGRLGRNAHSCCLQW
NGRSFSVWFHGLEAALPHPFSPTVGICLEYADRALAFYAVQDGKMSLLRRLKASRARRTG
TPASPVDPFQSRLDSHFAGLFTRRLKPAFFLESVDAHLQIGPLKKSCISVLKRR
Download sequence
Identical sequences ENSSSCP00000029355 ENSSSCP00000029355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]