SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029429 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029429
Domain Number 1 Region: 2-39
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 0.00000536
Family Phosphoglycerate kinase 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029429   Gene: ENSSSCG00000012440   Transcript: ENSSSCT00000035138
Sequence length 56
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:71339756:71342516:-1 gene:ENSSSCG00000012440 transcript:ENSSSCT00000035138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVKITLPVDFVTADKFDENAKIGQATVASGIPAGWMVVETLLPAVPNGTRRIKSAM
Download sequence
Identical sequences ENSSSCP00000029429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]