SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029485 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029485
Domain Number 1 Region: 1267-1438
Classification Level Classification E-value
Superfamily vWA-like 4.08e-44
Family Integrin A (or I) domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1051-1243
Classification Level Classification E-value
Superfamily vWA-like 1.32e-42
Family Integrin A (or I) domain 0.0000000515
Further Details:      
 
Domain Number 3 Region: 431-493
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000000785
Family BSTI 0.073
Further Details:      
 
Domain Number 4 Region: 78-132
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000536
Family BSTI 0.05
Further Details:      
 
Domain Number 5 Region: 557-613
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000157
Family ATI-like 0.02
Further Details:      
 
Domain Number 6 Region: 927-980
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000605
Family ATI-like 0.056
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000029485
Domain Number - Region: 611-677
Classification Level Classification E-value
Superfamily FnI-like domain 0.001
Family VWC domain 0.041
Further Details:      
 
Domain Number - Region: 483-524
Classification Level Classification E-value
Superfamily FnI-like domain 0.00188
Family VWC domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029485   Gene: ENSSSCG00000000712   Transcript: ENSSSCT00000036466
Sequence length 1471
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:67005381:67078134:1 gene:ENSSSCG00000000712 transcript:ENSSSCT00000036466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGLWEQCQLLKSASVFARCHPLVDPEPFVALCEKMLCPCAQGLQCPCPALLEYARACA
QQGMLLYGWMDHSLCRPDCPAGMEYRECVSPCTRTCQSLHINEVCQEQCVDGCSCPEGQL
LDDGRCVESAECSCVHSGKRYPPGASLSRDCNTCICRNSLWVCSNEDCPGECLVTGQSHF
KSFDNRHFTFSGVCQYLLARDCQDHTFSVIIETVQCADDPDAVCTRSVTVRLPSPHNSLV
KLKHGGGVAMDGWDVQIPFLQGDLRIQHTVMASVHLSYGEDLQIDWDGRGRLLVKLSPVY
AGRTCGLCGNYNGNQGDDFLTPAGLVEPLVEHFGNAWKLHGDCEDLRKQPTDPCSLNPRL
TRFAEEACAILTSPKFQACHDAVGPLPYLQNCHYDVCSCSDGRDCLCDAVATYAAACARR
GVHIGWREPGFCALSCPPGQVYLQCGTPCNLTCRSLSYPDEECAEDCLEGCFCPPGLYLD
GSGDCVPKAQCPCYHDGEIFQPEDIFSDHHTMCYCEDGFMHCSRAGAPGSLQPEVVLSSP
LSHRSKRSLSCRPPMVKLVCPADNPRAEGLECAKTCQNYDLECVSTGCVSGCLCPPGMVR
HENRCVALQRCPCFHQGREYAPGETVKVDCNTCVCRDRKWSCTDHVCDASCSALGLAHYL
TFDGLKYLFPGECQYVLVQDYCGSNPGTFRILLGNEGCGYPSLKCRKRVTILVDGGEIEL
FDGEVMVKKPLKDETHFEVVESGRFITVLLGSGLSVVWDRHLGISVFLKQTYQEQVCGLC
GNFDGVQNNDLTGSSLQVEEDPVDFGNSWKVSPQCADTRKVPLDTSPATCHNNVMKQTMV
DSSCRILTSDIFQDCNKLVDPEPYLDVCIYDTCSCESIGDCACFCDTIAAYARVCAQHGK
VVTWRTATLCPQNCEERNLREDGYQCEWRYNSCAPACPVTCQHPEPLACPVSCVEGCHAH
CPPGKILDELLQTCVSPEDCPVCEAAGRRLAPGKKITLNPRDPAHCQICHCDGVNLTCEA
CAEPVPPTEGPVSPTTPYEEDTPEPPLHDFFCSKLLDLVFLLDGSDKLSEADFEALKVFV
VGMMEHLHISQKHIRVAVVEYHDGSHAYISLQDRKRPSELRRIASQVKYAGSEVASISEV
LKYTLFQIFGRVDRPEASRIALLLMASQEPRRLAQNLARYLQGLKKKKVTVIPVGIGPHV
SLKQIRLIEKQAPENKAFVVSGVDELEQRKNEIISYLCDLAPEVPAPTRRPLVAQVTVAP
ELPGVSTLEPKKRMVLDVVFVLEGSDKVGEANFNRSTEFVEEVIRRMDVGRDSVHVTVLQ
YSYVVAVEHSFREAQSKGEVLQRVREIRFQGGNRTNTGLALQYLSEHSFSASQGDREEAP
NLVYMVTGNPASDEIKRMPGDIQVVPIGVGPDVDMQELERLSWPNAPIFIQDFETLPREA
PDLVLQRCCSGEGPHLPTQAPVPGMQGPCVG
Download sequence
Identical sequences ENSSSCP00000029485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]