SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029548 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029548
Domain Number 1 Region: 43-114
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000868
Family VWC domain 0.032
Further Details:      
 
Domain Number 2 Region: 169-241
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000012
Family VWC domain 0.013
Further Details:      
 
Domain Number 3 Region: 116-177
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000241
Family VWC domain 0.025
Further Details:      
 
Domain Number 4 Region: 1-51
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000408
Family VWC domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029548   Gene: ENSSSCG00000008991   Transcript: ENSSSCT00000036677
Sequence length 250
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:77954504:77971357:1 gene:ENSSSCG00000008991 transcript:ENSSSCT00000036677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGTEWTASPCGVCSCAHGEVQCTPRPCPPLLCGHQELEFIPEGSCCPVCVGPGKPCSYEG
RVFQDGEDWPLSRCAKCVCRNGVAQCFTAHCQPLFCKQDETLVRVPGKCCPQCSSRSCST
ASQVHEHGEQWSENACTTCICDQGEVRCHKQACPPLRCEKGQRRAQRHGQCCEDCVSPTG
SCSHGGLMRYQDEMWKGSACEFCTCDRGQVTCQTGECAKVECGQGEDLIHLDGKCCPECI
SRNGYCVYEE
Download sequence
Identical sequences ENSSSCP00000029548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]