SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029570 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029570
Domain Number 1 Region: 21-220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-42
Family Pentraxin (pentaxin) 0.000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029570   Gene: ENSSSCG00000006403   Transcript: ENSSSCT00000035222
Sequence length 222
Comment pep:known chromosome:Sscrofa10.2:4:98764964:98772727:1 gene:ENSSSCG00000006403 transcript:ENSSSCT00000035222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLSLCLLVIISLSNAFAQTDMIGKAFVFPKESENSYVSLTARLTKPLTAFTVCLRVYT
DLNRDYSLFSYATKTQYNEILLFRGKTAVYSISVGGADVIFKPHQSSEPMHFCMTWESTS
GITELWVDGKPMVRRSLKRGYSLGTQASIILGQEQDAFAGGFEKNQCLVGDIGDVNMWDY
VLSPEEINTVYAGGTFSPNVLNWRALRYEMSGEVYVKPQLWP
Download sequence
Identical sequences F1RJ76
9823.ENSSSCP00000006826 ENSSSCP00000006826 ENSSSCP00000029570 ENSSSCP00000006826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]