SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029678 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029678
Domain Number 1 Region: 128-368
Classification Level Classification E-value
Superfamily vWA-like 1.53e-70
Family Integrin A (or I) domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 1129-1313
Classification Level Classification E-value
Superfamily Fibronectin type III 2.55e-36
Family Fibronectin type III 0.00000396
Further Details:      
 
Domain Number 3 Region: 1456-1657
Classification Level Classification E-value
Superfamily Fibronectin type III 1.36e-34
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 991-1109
Classification Level Classification E-value
Superfamily CalX-like 1.96e-19
Family CalX-beta domain 0.00076
Further Details:      
 
Domain Number 5 Region: 625-710
Classification Level Classification E-value
Superfamily Integrin beta tail domain 3.53e-18
Family Integrin beta tail domain 0.0028
Further Details:      
 
Domain Number 6 Region: 27-77
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000502
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 7 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000781
Family Integrin beta EGF-like domains 0.02
Further Details:      
 
Domain Number 8 Region: 580-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family Integrin beta EGF-like domains 0.008
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000029678
Domain Number - Region: 509-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0123
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 468-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0198
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029678   Gene: ENSSSCG00000017204   Transcript: ENSSSCT00000034728
Sequence length 1752
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:5597669:5627954:-1 gene:ENSSSCG00000017204 transcript:ENSSSCT00000034728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPRRSPWTSLLLAALLSVSFPGDMANRCKKAQVKSCTECIRVDKDCAYCTDEMFKERR
CNTQAELVAAGCQLESMVVMESSFEITEETQIDTTLRRSQVSPQGLRVRLRPGEERHFEL
QVFEPQESPMDLYILMDFSNSMSDDLDNLKKMGQDLANVLRQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVEEFRTKLKGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMKRNDEECHLDATGTYTQYK
AQDYPSVPTLVRLLGRHNIIPIFAVTNYSYSYYEKLSSYFPVSSLGVLQEDSSNILDLLR
EAFDRIRSNLDIRALESPRGLRTEVTSKIFLKTDTGSFHIRRGEVGTYQVQLRAIEDLDG
THVCQLPEADQKGNIHLKPSFSDGLRMDVDIICDVCSCELQKEEQSPRCSFHGDFMCGHC
VCSEGWSGKTCNCRTGSLSDLEPCLREGEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYD
NFQCPRTSGFLCNDRGRCSMGQCVCEPGWTGLSCDCPLSNATCIDSNGGVCNGRGNCECG
RCHCNQQSLYTDTVCEINHSAIRLGLCEDLRSCVQCQAWGTGEKKGHTCKECSFKVKMVD
ELKKAEEVVEYCSFRDEDDDCTYSYTVEGDGAPGPNSTVLVQRRKECPPGTFWWLIPLLI
FLLLFPALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPML
RSGNLKGRDTVRWKITNNVQRPGFASHAAGINPTELVPYGLSLRLARLCTENLLKPDTRE
CDQLRQEVEENLNEVYRQIAGAHQVQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKQALL
KLTEKHVEQGAFHDLKVARGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQ
LLVEAIDVPVGTATLGRRLVNITIIKEQASGIVSFEQPEYFVSSGEHVARIPVVRRVLDN
GRSQVSYRTQDNTAHGSRDYIPAEGELLFQPGETWKELQVKLLELQEMDSLLRGRQPRRF
YIQLSNPKFGARLGQPHLATVIIGDRDEVDRNFVNQTLSSPPPPRGELGAPQNPNAKAAG
SRKIHFNWLPPPGKPTGYRVKYWIQGDPESEAHLLDSTVPSVELTNLYPYCDYEMKVCAY
GAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGL
VNEDNRPIGPMKKVLVDSPKRRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQ
PKRPMSIPIIPDIPIVDAQGGEDYESFLMYSDDVLRSPAGSQRPSVSDDTEHLVNGRMDC
AFPGSANSLHRMTVSNAAYGPHLSPHLPRHVLSTSSTLTRDYHSLTRTEHSHSATLPRDY
STLTSLSSQNSRLAAGVPNTPTRLVFSALGPTSLKVSWQEPQCERALQGYSVEYQLLNGG
ELHRLNIPNPSQTSVVVEDLLPNHSYVFRVRAQSQEGWGPEREGVITIESQVHPQSPLLP
LPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPDGDILGYLVTCEMAHGGEPATTF
LVDGDSPESRLTVPGLSENVPYKFKVQAKTTQGFGPEREGIITIESQDGGPFPQLGSHSG
LFQLPVSGEYSSITTTHTSTAEPFLLDGLTLGSQRLEASGSLTRHVTQEFVSRTLTSTGT
LSSQVDQQFFQS
Download sequence
Identical sequences ENSSSCP00000029678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]