SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029687 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000029687
Domain Number - Region: 115-149
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0245
Family NlpC/P60 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029687   Gene: ENSSSCG00000005967   Transcript: ENSSSCT00000034549
Sequence length 312
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:13883560:13886484:1 gene:ENSSSCG00000005967 transcript:ENSSSCT00000034549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNQVEKLTHLSYKEVPTADPTGVDRDDGPRIGVSYIFSNDDEDVEPQPPPQGLDGGGGG
LPDSGDGPPLPPPQPYDPRLHEVECSVFYRDECIYQKSFAPGSAALSTYTPENLLNKCRP
GDLVEFVSQAQYPHWAVYVGNFQVVHLHRLEVSNSFLTDASQGRRGRVVNDLYRYKPLSP
SAVVRNALAHVGAKERELSWRNSESFAAWCRYGKREFKIGGELRIGKQPYRLQIQLSAQR
SHTLEFQSLEDLIMEKRRNDQIGRAAVLQELATHLHPAEPDEGDSDAARTTPPPGRPQAP
GQEEEDREAVVH
Download sequence
Identical sequences F1RRR7
ENSSSCP00000006375 XP_005662907.1.46622 XP_005662908.1.46622 XP_005662909.1.46622 ENSSSCP00000006375 ENSSSCP00000029687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]