SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029692 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029692
Domain Number 1 Region: 588-666,883-1089
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.02e-62
Family Protein kinases, catalytic subunit 0.00051
Further Details:      
 
Domain Number 2 Region: 104-355
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.02e-18
Family Quinoprotein alcohol dehydrogenase-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029692   Gene: ENSSSCG00000008208   Transcript: ENSSSCT00000032709
Sequence length 1116
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:60031206:60114512:1 gene:ENSSSCG00000008208 transcript:ENSSSCT00000032709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERATRPGSLARALLLLLLLLGLSTGTVVARRASELPTPTSKAAFGLGAAAAPTSAARVP
ASGAVTAAEVTVEDAEALPAAAGEQEPRDPEPDDDPDLRPFGRSLVIISTLDGRIAALDP
ENHGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGDLFQWDRDRESMETVPFTVES
LLESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRQWDNDEMEQEEDILLLQR
TQKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTLKPSGNKEQSKIIVDVEE
QEAATTDTVIKVSVADWKVMAFSKKGGQLEWEYQFCTPIASAWLVKDGKVIPISLFDDTS
YVTNDGVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPTSPKALESVNSE
NTIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGY
YLPYYKRERSKRSTQITVRFLDNPNYNKNIRKKDPVLLLHWWKEIVGTILFCIIATTFIV
RRLFHPHPHRQRKESETQCQTENKYDSVSAEANDSNWNDVKNSGYVSRYLTDFEPIQCMG
RGGFGVVFEARNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLE
APPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRVDPGSTKEHIEIIAPSPRSSR
SFSMGISCGQTSSSESQFSPLELSGMDHGDASQSVDAAYNLQDSCLTDCDLEDGTLDGSN
DGHSFELCPSESSPYIRSRERTSSSIVFEDSGCDNASSKEEPRMNRLPIGNHCANKLTAL
QHSSSKSSSEPTLSISPPRPTTLSLDLTKNTTEKLQPSSPKVYLYIQMQLCRKENLKDWL
NSRCTIEERERSVCLHIFLQIVEAVEFLHSKGLMHRDLKPSNIFFAMDDVVKVGDFGLVT
AMDQDEEDEMVLTPMPGYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLYP
FGTQMERVRILTDVRDLKFPPLFTQKYPREFAMVQDMLSPSPTERPEAANIIENAIFEDL
EFPGKTVLRQRSRSMSSSGTKHSRHSSSCHSPLPSN
Download sequence
Identical sequences ENSSSCP00000029692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]