SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029769 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029769
Domain Number 1 Region: 29-165
Classification Level Classification E-value
Superfamily C-type lectin-like 7.42e-24
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 2 Region: 234-352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000122
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029769   Gene: ENSSSCG00000029949   Transcript: ENSSSCT00000035792
Sequence length 769
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:5146945:5149536:1 gene:ENSSSCG00000029949 transcript:ENSSSCT00000035792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRLLLAWAAALPTLGQAPWATKPRAACSPGSCYALFPRRRTFLEAWRACRELGGDLAT
PRTPEEAQRVDSLVGSGPPSRLLWIGLQRQARQCQPQRPLRGFTWTTGDQDTAFTNWAQP
ATGGPCPAQRCAALEASGEHRWLEGSCTLAVDGYLCQFGFEGSCPALPDEAGQAGPAVYT
TPFHLVSTEFEWLPFGSVAAVPCQAGREASLLCVKQPDGGVGWSRTGPLCPGTGCGPDNG
GCEHECVEEADGRVSCRCTEGFRLAEDGRSCEDPCAHAPCEQQCEPGGPQGYSCHCRLGF
RPAEDEPHRCVDTDECQIAGVCQQMCVNYVGGFECYCSEGHELEADGISCSPTGAMGAPA
SQDLGDELLDDGEDEEDEDEGWEAFDGGWTEMPGVPWMEATQSSDFGLAYRPSFPEDGEP
RMPYLDPTWPPPLSAPRVPYHSSVLSVTRPVVVSAPRPTLPSAHQPSVISATRPPLAPAP
QPPVMPAVHPALPPDHHFPMVSANYPELPSAHRPPTVSATDLGPTPAQQPPIISAKYPEL
SPAHQSPLYLDSQVVDSQATTHLPRIPAIHTSLVTTSSPHQPPVTPEVPVLRAQTTHLPM
TSSVQPPLTTTSRSPVPPAPQVPVPAATHPPAFHTPSPPQSPTNQSSLSSSIHPHSKAPH
VPREGAPDPNLAPWLPSAAPTALGEASSAGRSRRDDRWLLVALLVPTCVFLVVLLALGIV
YCTRCGPHAPNKRVTDCYRWVTHAGSKGPTEPAPHRGSLTGVQTCRTSV
Download sequence
Identical sequences K7GPF5
XP_003122563.1.46622 ENSSSCP00000029769 ENSSSCP00000029769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]