SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029807 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029807
Domain Number 1 Region: 870-1084
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-107
Family Thrombospondin C-terminal domain 0.00000000111
Further Details:      
 
Domain Number 2 Region: 747-868
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.71e-37
Family TSP type-3 repeat 0.000000134
Further Details:      
 
Domain Number 3 Region: 15-148
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-25
Family Laminin G-like module 0.000000342
Further Details:      
 
Domain Number 4 Region: 406-458
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.96e-17
Family TSP-1 type 1 repeat 0.0000297
Further Details:      
 
Domain Number 5 Region: 350-400
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 5.49e-16
Family TSP-1 type 1 repeat 0.0000342
Further Details:      
 
Domain Number 6 Region: 676-749
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000196
Family TSP type-3 repeat 0.00022
Further Details:      
 
Domain Number 7 Region: 232-289
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000366
Family VWC domain 0.0079
Further Details:      
 
Domain Number 8 Region: 606-690
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000353
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 9 Region: 294-343
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000301
Family TSP-1 type 1 repeat 0.00067
Further Details:      
 
Domain Number 10 Region: 462-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000321
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029807   Gene: ENSSSCG00000004789   Transcript: ENSSSCT00000034520
Sequence length 1085
Comment pep:novel chromosome:Sscrofa10.2:1:146907924:146923333:-1 gene:ENSSSCG00000004789 transcript:ENSSSCT00000034520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLAWGLSVLFLLHTRGTLLAVERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQQVVSVEE
ALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSIFTRDLASIANLRIAKGGVN
DNFQGVLQNVRFVFGTTPEDILRNKGCSSSTNVLLTLDNNVVNGSSPAIRTNYIGHKTKD
LQAICGISCDELSSMVLELRGLRTIVTTLQDSIRKVTEENKELASELRRPPLCYHNGVQY
RNNEEWTVDSCTECRCQNSVTICKKVSCPIMPCSNATVPDGECCPRCWPSDSADDGWSPW
SEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSVQTRTCHIQECDKRFKQDGGWSHWSPWS
SCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACQRDACPINGGWGPWSPWDICS
VTCGGGVQRRSRLCNNPAPQFGGKDCVGDETENQICNKQDCPIDGCLSNPCFAGAKCTSY
PDGSWKCGACPPGYSGNGIQCEDVDECKEVPDACFNHNGEHRCKNTDPGYNCLPCPPRFT
GSQPFGRSVEYATANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGN
GIICGEDTDLDGWPNEDLVCVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDND
KIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNPDQADTDNNGEGDACAADIDGDG
ILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEHNPDQLDSDSDRIGDTCDNNQDIDED
GHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDRDNCRLVPNPDQKDSDGDG
RGDACKDDFDHDNVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKE
LVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQ
SYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDF
TAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKY
ECRDS
Download sequence
Identical sequences ENSSSCP00000029807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]