SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029826 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029826
Domain Number 1 Region: 21-152
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000549
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 2 Region: 161-202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000509
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029826   Gene: ENSSSCG00000021675   Transcript: ENSSSCT00000034226
Sequence length 313
Comment pep:novel chromosome:Sscrofa10.2:2:64160636:64172117:1 gene:ENSSSCG00000021675 transcript:ENSSSCT00000034226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSTAELTGLCTMRNRYLRLLPDINECAPPTAVSCGKGADCQNTEGSYHCICVPGYELASG
APVFRNENENTCQDVDECQQKLRICKSHSICINTQGSYTCQCLPGFKLNPRDPKLCTDVN
ECTLGSNPCHNSTYCFNLVGRYECPCRPGWKPIPGSPNGPNNTICEDKDECSSGEHHCHN
STICTNTVGSYVCHCPQGWVPKPGFQNKKNTTICEEVSFPTWMPPPGIKSQRLSRFFHRL
QDLRGNFSSVSVQSTVQGLIQEVGDLLEGPQDLENLSQSEQQFVATNLLLGLENALGWLG
KALPIGAVTFSSS
Download sequence
Identical sequences ENSSSCP00000029826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]