SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029910 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029910
Domain Number 1 Region: 2-109
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-23
Family Phosphate binding protein-like 0.000000876
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029910   Gene: ENSSSCG00000004361   Transcript: ENSSSCT00000034534
Sequence length 213
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:77521349:77554699:1 gene:ENSSSCG00000004361 transcript:ENSSSCT00000034534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQI
GGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEASAL
GVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRL
KHKPQAPVIVKTEEVINMHTFNDRRLPGKETMA
Download sequence
Identical sequences G1NLC9 Q9BZ15
ENSSSCP00000029910 ENSMGAP00000014315 XP_009501324.1.22320 XP_009675201.1.43253 XP_009921031.1.2804 XP_009959822.1.99599 XP_010075342.1.40768 XP_010130223.1.100080 XP_010159745.1.22856 ENSMGAP00000014315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]