SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029927 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029927
Domain Number 1 Region: 339-588
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.04e-70
Family Eukaryotic proteases 0.00069
Further Details:      
 
Domain Number 2 Region: 128-234
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0058
Further Details:      
 
Domain Number 3 Region: 274-309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 237-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 5 Region: 64-124
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000206
Family Ovomucoid domain III-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029927   Gene: ENSSSCG00000009138   Transcript: ENSSSCT00000035235
Sequence length 598
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:120517217:120554318:1 gene:ENSSSCG00000009138 transcript:ENSSSCT00000035235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLAHVILLLLCFYLSFCKVNCARKRKKVVTKLEPTSGSDTSQEDLVEKKCLTEKYTHLS
CDKVFCQPWQKCIDGTCICKLPYQCPKNGTSVCSTNGKSYPTYCQQKSFECLRPEAKFLK
SGACTGEEQFSVSLDRGNGDSEGIVEVKLVDQDKKMYICAKSWSLTQANVACLDLGFKLG
ALYTQRRDPHINSPECLHVHCRGSETSLAECTFTKGTTSRSEGLAGVVCYTENAVSPTND
YFQCVNGKHISQKKTCDGINDCGDQSDELCCKGCRGESFFCKSGVCIPRKYKCNGEVDCI
TGEDEVGCEGSEHPEIKEETEMLTADMNAERKRIKSFFPKLSCGVKSSTHIRRKRVVGGQ
PAEVGDFPWQVAIKEGEKINCGGIYIGGCWILTAAHCVRASKAPRYQIWTSFTDWLNPDP
QIVVQFVKQVIIHEKYNGTTYQNDIALIEMKKQPGRSECVLLKSVPACVPWSPHLFQPND
KCIVSGWGREKDNKKVYSLKWGEVHLISNCSKFYLNRFFEKEMVCAGTDDGSIDACKGDS
GGPLVCTDANNMTYVWGVVSWGENCGKPEFPGVYTKVANYFDWISLHVGRPLISQHNV
Download sequence
Identical sequences ENSSSCP00000029927 ENSSSCP00000029927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]