SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029942 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029942
Domain Number 1 Region: 375-690
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.16e-77
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-33
Family Spermadhesin, CUB domain 0.0000144
Further Details:      
 
Domain Number 3 Region: 158-270
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-32
Family Spermadhesin, CUB domain 0.0000258
Further Details:      
 
Domain Number 4 Region: 274-344
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 108-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029942   Gene: ENSSSCG00000011806   Transcript: ENSSSCT00000033025
Sequence length 702
Comment pep:known chromosome:Sscrofa10.2:13:134301569:134349594:1 gene:ENSSSCG00000011806 transcript:ENSSSCT00000033025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGQIQSPGYPDSYPSDSEVTWNITVPEGFRIKLYFMHFNLESSYLCEYDYVKVETEDQV
LATFCGKETTDTEQTPGQEVVFSPGSFMSITFRSDFSNEERYTGFDAHYMAVDVDECTER
EDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDYPSPY
PKSSECLYTIELEEGFMVSLQFEDIFDIEDHPEVSCPYDYIKIKAGPKLLGPFCGEKAPE
PINTQSHSIQIQFRSDNSGENRGWRLLYRATGNECPKLQPPVHGKIEPLQAKYSFKDQVL
ISCDTGYKVLKDNVEMDVFQIECLKDGTWSNKIPTCKIADCGTPAKLENGLVTFSTRNNL
TTYKSEIIYSCQQPYYKMLHSTTGVYTCSAQGVWMNEVLGKSQPTCLPVCGQPSRSLPNL
VKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSESWILTAAHVLRSQRRDN
TVTPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFDIQNYNHDIALVQLQEPVPLG
PHVMPVCLPRPEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVP
HAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVILDDLSQRWVAQGLVSW
GGPEECGSKQVYGVYTKVSNYVDWVWEQMGSPPGLGELQVER
Download sequence
Identical sequences ENSSSCP00000029942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]