SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030087 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030087
Domain Number 1 Region: 168-373
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-35
Family Laminin G-like module 0.000000156
Further Details:      
 
Domain Number 2 Region: 2-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.01e-34
Family Laminin G-like module 0.000000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030087   Gene: ENSSSCG00000009565   Transcript: ENSSSCT00000035263
Sequence length 377
Comment pep:known chromosome:Sscrofa10.2:11:86582221:86591879:-1 gene:ENSSSCG00000009565 transcript:ENSSSCT00000035263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSGTPVIRLRFKRLQPTRLVAEFDFRTFDPEGVLFFAGGRQDSTWIVLGLRAGRLELQL
RYQGVGRVTSSGPVINHGVWQTISVEELERNLVVKVNRDAVMKIAVAGELFQLDRGLYHL
NLTVGGIPFKEKDLVQPMNPRLDGCMRSWNWLNGEDTTIQETVRVNAKMQCFSLTERGSF
FPGTGFALYSLDYARTSPDIGAETFWEVEAVARIRPATDTGVLLALVGGDQAVVLSVALV
DYHSTKKLKKQLVVLAAESVTLALMEIKVCDGQEHVVTVSVNKDEATLEVDGTRGQRDVS
PAGLQERLVLLGRHLQGSVLTFIGGLPDVPVTSAPVTAFYRGCMTLEVNGKALDLDEATY
KHSDITAHSCPPVEPAA
Download sequence
Identical sequences ENSSSCP00000030087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]