SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030183 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030183
Domain Number 1 Region: 195-505
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.83e-119
Family Transglutaminase core 0.0000000000228
Further Details:      
 
Domain Number 2 Region: 11-194
Classification Level Classification E-value
Superfamily E set domains 2.41e-55
Family Transglutaminase N-terminal domain 0.0000000305
Further Details:      
 
Domain Number 3 Region: 520-631
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.1e-31
Family Transglutaminase, two C-terminal domains 0.00000341
Further Details:      
 
Domain Number 4 Region: 633-731
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.22e-27
Family Transglutaminase, two C-terminal domains 0.00000419
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030183   Gene: ENSSSCG00000024310   Transcript: ENSSSCT00000035671
Sequence length 735
Comment pep:novel chromosome:Sscrofa10.2:7:3952957:4100229:-1 gene:ENSSSCG00000024310 transcript:ENSSSCT00000035671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETPGTGAAFGGRRALPPNTSNAEENDPPTVELQGGLMPRGFNPQDYLNVTDVHLFKER
WDSNKVDHHTDKYDSKKLIVRRGQPFYIQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTY
IPVPIVSELQRGKWGAKVITTEDRSVRLSVQPSPDCIVGKFRMYVAVWTPYGVIRTSRNP
ETDTYILFNPWCEEDAVYLDNDKEREEYVLNDIGVIFYGEFNDIKSRSWSYGQFEEGILD
ACLYMMDRAKMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNVYSYGVPPSAWTGSV
DILLEYKSSQTPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNNANLQLDIFLEE
DGNVNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDSTPQENSDGMYRCGPASVQA
IKHGHVCFQFDAPFVFAEVNSDVIYITAKKDGTHVVKTLDTTHIGKLIVTKQVGADGMKD
ITDTYKFQEGQEEERLALETALMYGAKKPLSTEGIPKSRSDIHMDFEVERAVLGRDFKVV
LTFRNNSPTRYSVTAYLSGNITFYTGVSKGEFKNETFNVTLEPLSFKTEAVWVRAGEYMG
QLLEQAFLHFFVTARVNETNDVLAKQKSVVLTIPKISVKVRGTQAVGSDMVVTVEFTNPL
NEPLQNVWMRLDGPGVTRPLRKIFREIRPNATVQWEEVCRPWVSGPRKLMASMTSDSLRH
VYGELNLHIQRRPSV
Download sequence
Identical sequences K7GQL2
ENSSSCP00000001089 9823.ENSSSCP00000001088 XP_001927665.3.46622 ENSSSCP00000030183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]