SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030258 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030258
Domain Number 1 Region: 3-128
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.4e-25
Family Autophagin-like 0.00000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030258   Gene: ENSSSCG00000012569   Transcript: ENSSSCT00000032915
Sequence length 158
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:103044907:103063023:1 gene:ENSSSCG00000012569 transcript:ENSSSCT00000032915 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XKSKLLADISARLWFTYRRKFSPIDWNWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMEK
MCCASALSADAAVESRRDSLNASTQSKGPSACRPAWKPLLLIVPLRLGINQINPVYVDAF
KVMSSFSWTLTQPRPLWTLKRMEWLTTRLSTVCSPPSE
Download sequence
Identical sequences ENSSSCP00000030258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]