SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030311 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030311
Domain Number 1 Region: 173-227,254-269,297-315
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.8e-17
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 2 Region: 91-174
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.33e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030311   Gene: ENSSSCG00000006646   Transcript: ENSSSCT00000033780
Sequence length 347
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:107586979:107636238:1 gene:ENSSSCG00000006646 transcript:ENSSSCT00000033780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATTANPEMTADVPSLGPAITSGNPGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFL
RCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSMNRLSFVRNRCRNGLGSVKDGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGLPGDAVHVGRPEQQLQQ
Download sequence
Identical sequences ENSSSCP00000030311 ENSSSCP00000030907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]