SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030393 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030393
Domain Number 1 Region: 168-348
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-50
Family SPRY domain 0.00087
Further Details:      
 
Domain Number 2 Region: 62-173
Classification Level Classification E-value
Superfamily Fibronectin type III 5.28e-16
Family Fibronectin type III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030393   Gene: ENSSSCG00000012110   Transcript: ENSSSCT00000036668
Sequence length 350
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:7635071:7665887:-1 gene:ENSSSCG00000012110 transcript:ENSSSCT00000036668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRVGSERNKQFPRQMCEERPGAMSSSLGVSMATASSQVLIPEINLNDTFDTFALDFSREK
KLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTIFTGQANVVSL
CNSADSWMIVPNIKQNHYTVHGLQSGTKYIFIVKAINQAGSRSSEPGKLKTNSQPFKLDP
KSAHRKLKVSHDNLTVERDESSSKKSHTPERFTSQGSYGVAGNVFIDSGRHYWEVVISGS
TWYAIGLAYKSAPKHEWIGKNSASWALCRCHNTWVVRHNSKEVPIEPAPHLRRVGILLDY
DNGSVAFYDALNSLHLYTFDVTFSQPVCPTFTVWNKCLTIITGLPIPDHL
Download sequence
Identical sequences ENSSSCP00000030393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]