SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030469 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030469
Domain Number 1 Region: 114-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000324
Family VWC domain 0.038
Further Details:      
 
Domain Number 2 Region: 258-325
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000558
Family VWC domain 0.0087
Further Details:      
 
Domain Number 3 Region: 36-102
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000753
Family VWC domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030469   Gene: ENSSSCG00000012576   Transcript: ENSSSCT00000035618
Sequence length 453
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:104267009:104398296:1 gene:ENSSSCG00000012576 transcript:ENSSSCT00000035618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKKWKMGGTSYIFSLLLLFLFLEGSKTEQVKHSETYCVFQDKKYRVGERWHPYLEPYGL
VYCVNCICSENGNVLCSRVRCPSLHCLSPVHVPHLCCPRCPDSLPPANNKVTSKSCEYNG
TTYQHGELFMAEGLFQNRQPNQCTQCSCSEGNVYCGLKTCPKLTCAFPVSVPDSCCRVCR
GDGELSWEHSDGDIFRQPANREARHSYHRSHYDPPPSRPAGSLPRFPGARSHRGALMDSQ
QASGTIVQIVINNKHKHGQVCVSNGKTYSHGESWHPNLRAFGIVECVLCTCNVTKQECKK
IHCPNRYPCKYPQKIDGKCCKVCPEELPSQSLDSKGYFCGEETMPVYESVFMEDGETTRK
IALETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELHHFKLVTRTTLSQWKIFTEGE
AQISQMCSSRVCRTELEDLVKVLYLERSEKGHC
Download sequence
Identical sequences ENSSSCP00000030469 ENSSSCP00000029890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]