SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030510 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030510
Domain Number 1 Region: 1-152
Classification Level Classification E-value
Superfamily Cupredoxins 1.1e-45
Family Multidomain cupredoxins 0.000000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030510   Gene: ENSSSCG00000011700   Transcript: ENSSSCT00000034886
Sequence length 163
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:97416076:97435280:-1 gene:ENSSSCG00000011700 transcript:ENSSSCT00000034886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGSYKKLVYREYKDASFTNRKERGPEEEHLGILGPVIWAEVGDTIRVTFRNKGAYPLSIE
PTGVRVSKSQEGTYYASHYISSSENVPPSASHVAPKETFTYEWTVPKEVGPTYKDPVCLT
KMYYSAVDPTKDIFTGLIGPMKICKKGSLLANGRLELHHSQER
Download sequence
Identical sequences ENSSSCP00000030510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]