SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030563 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000030563
Domain Number - Region: 282-324
Classification Level Classification E-value
Superfamily HMG-box 0.00102
Family HMG-box 0.009
Further Details:      
 
Domain Number - Region: 220-275
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0138
Family Di-heme elbow motif 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030563   Gene: ENSSSCG00000012401   Transcript: ENSSSCT00000034006
Sequence length 335
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:65020762:65030526:1 gene:ENSSSCG00000012401 transcript:ENSSSCT00000034006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAVFQSKSSNDVGKQDLGENLCQPPNDHPQAKLEISDRKLSADEEPVPVVEQPRKRKNKT
KNISVTPGPKKRGPSKKKPRAMKFEKCEPGNSQCKIPGCFLRGLENLKQYSGKNFKQNKD
ELVQKIYTLLNSSVFDKKMPEKIDIGWNKKMLRTAGLCTTGEIRYPKRERYAKIEIALKV
CDSADRLRDTLIHEVCHAASWLLDGVRDSHGDAWKYYARKSNMVHPELPKVTRCHNYEIN
YRIHYECTQCKSRVGRYTRSLNTDRFICARCRGSLVMLPLTRKDGTPIKPHVRPFAKYVQ
ENYRIVKREMAGIGHGDVMKKLSRDFLAKKQRQEL
Download sequence
Identical sequences ENSSSCP00000030563 ENSSSCP00000030563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]