SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030603 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030603
Domain Number 1 Region: 94-302
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.31e-58
Family DPP6 catalytic domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 3-86
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0000000183
Family DPP6 N-terminal domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030603   Gene: ENSSSCG00000004934   Transcript: ENSSSCT00000032958
Sequence length 311
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:181024843:181043492:-1 gene:ENSSSCG00000004934 transcript:ENSSSCT00000032958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XFEGTKDSPLEHHLYVVSYVNPGEVTRLTDRGYSHSCCISRHCDFFISKYSNQKNPHCVS
LYKLSSAEDDPTCKTKEFWATILDSAGPLPDYTPPEIFSFESTTGFTLYGMLYKPHDLQP
GKKYPTVLFIYGGPQGQIEIDDQVEGLQYLASQYDFIDLDRVGIHGWSYGGYLSLMALMQ
RSDIFRVAIAGAPVTLWIFYDTGYTERYMGHPDQNEQGYYLGSVAMQAEKFPSEPNRLLL
LHGFLDENVHFAHTSILLSFLVRAGKPYDLQIYPQERHSIRVPESGEHYELHLLHYLQEN
LGSRIAALKVI
Download sequence
Identical sequences ENSSSCP00000030603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]