SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030635 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030635
Domain Number 1 Region: 125-256
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.34e-46
Family Galectin (animal S-lectin) 0.000000438
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030635   Gene: ENSSSCG00000005055   Transcript: ENSSSCT00000032888
Sequence length 260
Comment pep:known chromosome:Sscrofa10.2:1:204964081:204974124:1 gene:ENSSSCG00000005055 transcript:ENSSSCT00000032888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGFSLNDALSGSGKPNPQGWPGAWGNQPAGPGGYPGASYPGTYPGQGPPGAYPGQAPP
GAYPGQAPPGAYPGPTAPGYPGPAAPGAYPGQPGGPGAYPPPAQPSAPGAYPATGPYGAP
SGPLNVPYDLPLPGGVMPRMLITILGTVKPNANRLALDFKKGNDVAFHFNPRFNEDNRRV
IVCNSKLDNNWGREERQMVFPFECGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRMRNLRE
ISKLGISGDITLTSASHTMI
Download sequence
Identical sequences A3EX84
NP_001090970.1.46622 XP_005660031.1.46622 ENSSSCP00000005434 ENSSSCP00000030635 9823.ENSSSCP00000005434 ENSSSCP00000005434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]