SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030642 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030642
Domain Number 1 Region: 38-174
Classification Level Classification E-value
Superfamily C-type lectin-like 1.01e-36
Family C-type lectin domain 0.00000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030642   Gene: ENSSSCG00000028309   Transcript: ENSSSCT00000033413
Sequence length 176
Comment pep:novel chromosome:Sscrofa10.2:3:68016739:68019650:1 gene:ENSSSCG00000028309 transcript:ENSSSCT00000033413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLPSMGLPSLFWMLLSCLMLLSQVQGEDSPADTPSARISCPKGSMAYASYCYALFITPK
TWMGADMACQKRPSGHLASVLSGAEASFMSSLIKNNLNALSDVWIGLHDPTEGLEPNAGG
WEWSSSDVLNYVAWERNPSTSSYPGYCGSLSRNTGYLKWRDYNCYVNLPYVCKFKD
Download sequence
Identical sequences XP_005662486.1.46622 ENSSSCP00000008815 ENSSSCP00000008816 ENSSSCP00000028372 ENSSSCP00000030642 ENSSSCP00000008815 ENSSSCP00000008816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]