SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030649 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030649
Domain Number 1 Region: 18-175
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.39e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000978
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030649   Gene: ENSSSCG00000026932   Transcript: ENSSSCT00000036652
Sequence length 180
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:16294152:16317530:-1 gene:ENSSSCG00000026932 transcript:ENSSSCT00000036652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRKIEGFLFLLLFGYEECPYHKPLGFESGEVTPDQITCSNLEQYVGWYSSWTANKARLN
SQGFGCAWLSKFQDSSQWLQIDLKEVKVISGILTQGRCDIDEWMTKYSVQYRTDESLNWI
YYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCT
Download sequence
Identical sequences ENSSSCP00000030649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]