SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030657 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000030657
Domain Number - Region: 7-37
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0402
Family NlpC/P60 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030657   Gene: ENSSSCG00000026914   Transcript: ENSSSCT00000035840
Sequence length 199
Comment pep:putative chromosome:Sscrofa10.2:2:7653559:7669996:1 gene:ENSSSCG00000026914 transcript:ENSSSCT00000035840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALIPEPQLGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEIAGAGAASLMSALTDKALV
KKELLYEVAGRDRYQVNNKHDGKYSPLPPSKIVQRAEELVGQEVLYKLTSENCEHFVNEL
RYGVARSDQVCAGRVRVPGNLTISSSDLDIGVGSAGWRRAKPRGTSRTSPCPGGCPGGGG
CGWGEGCCRPLGCRALARA
Download sequence
Identical sequences ENSSSCP00000030506 ENSSSCP00000030657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]