SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030663 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030663
Domain Number 1 Region: 389-518
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000361
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number 2 Region: 679-805
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000581
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 3 Region: 361-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000192
Family EGF-type module 0.007
Further Details:      
 
Domain Number 4 Region: 577-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000352
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 328-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000205
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 612-652
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000207
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 288-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000205
Family EGF-type module 0.019
Further Details:      
 
Domain Number 8 Region: 656-690
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000315
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000030663
Domain Number - Region: 543-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000324
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030663   Gene: ENSSSCG00000002555   Transcript: ENSSSCT00000036274
Sequence length 971
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:131225957:131245220:-1 gene:ENSSSCG00000002555 transcript:ENSSSCT00000036274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCLKEYQAK
VTPTGPCNYGHGATPVLGGNSFYLPPAGAAGDRARARARAGGDQDPGLVVIPFQFAWPRS
FTLIVEAWDWDNDTTPDEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELKIRVRCDEN
YYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCAVPGE
CRCSYGWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWGGLLCNKDLNYCGSHHPCTHGG
TCINAEPDQYRCVCPDGYSGRNCERAEHACASNPCANGGSCHEVPSGFECHCPAGWSGPT
CALDIDECASSPCAAGGTCVDQVDGFECICPEQWVGATCQLDINDCRGQCQHGGTCKDLV
NGYQCVCPRGFGGRHCERELDECASSPCHGGFCQDLVDGFRCHCPQGFSGPLCEVDIDFC
EPSPCQNGAPCYNLEGDYYCACPDHVSGKNCSELREPCPGGACRVVDGCGLEPGTRVAGG
VAPSSVCGPHGHCVSQPGGNFSCVCDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFR
CFCPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSRESQCDAY
TCGNGGTCYDSGDTFRCACPPGWRGSTCNIAKNSSCLPNPCVNGGTCVGSGDSFSCICRD
GWEGRTCTHNTNDCNPLPCYNGGVCVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYG
ATCVDEINGYRCSCPPGRAGPRCQEVMVFGRSCWSQGVPFPHGSSWVEDCNSCRCLDGRR
DCSKVWCGRKPCLLAGRSAALNAQCPPGQRCQEKAPGQCLQPPCAAWGECGAEEALLPST
PCRPRSGHLDNNCARLTLRFNRDQVPQGTTVGAICSGIRALPATRAVARDRLLVLLCDRP
SSEASAVEVAL
Download sequence
Identical sequences ENSSSCP00000030663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]