SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030667 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030667
Domain Number 1 Region: 363-537
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-39
Family SPRY domain 0.00044
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily RING/U-box 1.15e-20
Family RING finger domain, C3HC4 0.0096
Further Details:      
 
Domain Number 3 Region: 89-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000748
Family B-box zinc-binding domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000030667
Domain Number - Region: 153-265
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00266
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030667   Gene: ENSSSCG00000028173   Transcript: ENSSSCT00000035216
Sequence length 544
Comment pep:known chromosome:Sscrofa10.2:7:25106666:25119614:1 gene:ENSSSCG00000028173 transcript:ENSSSCT00000035216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQQFTNKLQEEVICPICMDILQDPATIDCGHSFCLQCIMRSREGLDSVIKCPLCNKIV
KRDTIRPNWLLVNLVEKIQAMDPSEEQPEVKELKCPKHGERFHYFCESDGKVLCVACCGS
KDHKFHNTILLEEAAQSFQAQVEQEKQKISTVFEQLLQALKEEKNFLLSRINWLDQELTK
DRNSYLASAEAQLQSLRKLKDSLKARQLLPPREMLQDIKPVLSRSAGFRFLSPPPVSADL
EKKLNETKLRHESLIESLKKFQDKCQADGKKDKSRFLKGLDKHYIKSWYLLEKSNPTPME
TLEPELSPSDDRNAKPLPPKLKLSPSLPNLFRSRSRASIASFVFYSNEDSSEDPGSPGAA
WTEELKAALTPVTLDAASAHPDLIISQDLKTVTLDPVPQSRCAEPTDPARFHPFRCVLGL
PGLSSGCQTWEAELEGPEGGGCLVGVASELVTRRGPLMIEPLTGFWVLRIVGFDCQALTE
GGTREELSVRPRKVGVHVNHEGGEVVFYDSITSSRIYTFHTSFPGQVLPFFRLLFPGTQI
TLSP
Download sequence
Identical sequences ENSSSCP00000030667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]