SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030716 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030716
Domain Number 1 Region: 274-425
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.42e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000757
Further Details:      
 
Domain Number 2 Region: 428-585
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.03e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000696
Further Details:      
 
Domain Number 3 Region: 645-803
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.59e-37
Family MAM domain 0.0014
Further Details:      
 
Domain Number 4 Region: 146-263
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-33
Family Spermadhesin, CUB domain 0.00000114
Further Details:      
 
Domain Number 5 Region: 34-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-32
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030716   Gene: ENSSSCG00000011102   Transcript: ENSSSCT00000034108
Sequence length 906
Comment pep:novel chromosome:Sscrofa10.2:10:61654577:61800188:-1 gene:ENSSSCG00000011102 transcript:ENSSSCT00000034108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGLPLLCAALALALGAAGALRNDKCGDTIKIESPGYLTSPGYPHSYHSSEKCEWLIQA
PEPYQRIMINFNPHFDLEDRDCKYDYVEVIDGENENGRLWGKFCGKIAPSPVVSSGPFLF
IKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIIFAP
KMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRVRSSS
GILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN
WSAERSRLHYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYRI
DISSNGEDWITIKEGNKPVIFQGNTNPTDVVFGVLPKPLITRFVRIKPVTWETGISMRFE
VYGCKITDYPCSGMLGMVSGLISDSQITASNQGDRNWMPENIRLVTSRSGWALPPAPHPY
VNEWLQVDLGEEKIVRGIIIQGGKHRENKVYMRKFKIGYSNNGSDWKMIMDDGKRKAKSF
EGNNNYDTPELRTFPPLSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLV
DECDDDQASCHSGTGDDFQLTGGTTVLTTEKPTIIDSTIQSEFPTYGFNCEFGWGSHKTF
CHWEHDSHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAH
CMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVI
FEGEIGKGSLGGIAVDDISISNHIPQEDCARSTPGYEGRGEGDENISRKPGSVLKTLDPI
LITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNFELVDGVKLKKDKLNPQ
STYSEA
Download sequence
Identical sequences ENSSSCP00000030716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]