SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030724 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030724
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.7e-16
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 2 Region: 352-411
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000353
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 3 Region: 300-354
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000902
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030724   Gene: ENSSSCG00000029488   Transcript: ENSSSCT00000036599
Sequence length 412
Comment pep:novel chromosome:Sscrofa10.2:13:200327943:200332110:1 gene:ENSSSCG00000029488 transcript:ENSSSCT00000036599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPVHGSWGPWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEGKRVRYRSCNIEDCPE
NNGKTFREEQCEAHNEFSKASFGSGPPVEWTPKYAGVSPKDRCKLICQAKGIGYFFVLQP
KVVDGTPCSPDSTSVCVQGQCVKAGCDRIIDSKKKFDKCGICGGNGSTCKKISGSVTSAK
PGYHDIVTIPTGATNIEVKQRNQRGSRNNGSFLAIKAADGTYILNGDFTLSTLEQDITYK
GSVLRYSGSSAALERIRSFSPLKEPLTIQVLTVGNALRPKIKYTYFVKKKKESFNAIPTF
SEWVIEEWGECSKTCGLGVQRRLVECRDINGQPASECAKEVKPASTRPCADLPCPHWQLG
DWSPCSKTCGKGYKKRTLQCLSHDGGVLAHESCDPLKKPKHYIDFCTMAECS
Download sequence
Identical sequences ENSSSCP00000030724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]