SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030775 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030775
Domain Number 1 Region: 138-380
Classification Level Classification E-value
Superfamily vWA-like 2e-84
Family Integrin A (or I) domain 0.000000204
Further Details:      
 
Domain Number 2 Region: 638-726
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.02e-22
Family Integrin beta tail domain 0.00099
Further Details:      
 
Domain Number 3 Region: 357-468
Classification Level Classification E-value
Superfamily Integrin domains 4.55e-21
Family Integrin domains 0.0012
Further Details:      
 
Domain Number 4 Region: 24-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000262
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000017
Family Integrin beta EGF-like domains 0.004
Further Details:      
 
Domain Number 6 Region: 554-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Integrin beta EGF-like domains 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000030775
Domain Number - Region: 520-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0271
Family Integrin beta EGF-like domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030775   Gene: ENSSSCG00000011101   Transcript: ENSSSCT00000035813
Sequence length 801
Comment pep:known_by_projection chromosome:Sscrofa10.2:10:61450695:61502769:-1 gene:ENSSSCG00000011101 transcript:ENSSSCT00000035813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLQLIFWIGLISSVCYVFGQADENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALRKKGCHPDDIENPRGSKNIKKNKNVTNRSKGTAEKLQPEDITQIQPQQLV
LQLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENDVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITANKCPNKNSETIKIKPLGFTEEVEIILQFICECECQSEGIPSSPKCHDG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTTSCM
AVNGQICNGRGVCECGVCKCTDPKFQGPTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSHFNITKVENRDKLPQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEATVHVVET
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTQEN
PIYKSPINNFKNPNYGRKAGL
Download sequence
Identical sequences K7GS94
XP_013835739.1.46622 ENSSSCP00000029594 ENSSSCP00000030775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]