SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030828 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030828
Domain Number 1 Region: 299-484
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-72
Family SPRY domain 0.00000254
Further Details:      
 
Domain Number 2 Region: 18-91
Classification Level Classification E-value
Superfamily RING/U-box 2.91e-22
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 3 Region: 101-162
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.14e-17
Family B-box zinc-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030828   Gene: ENSSSCG00000001342   Transcript: ENSSSCT00000035776
Sequence length 488
Comment pep:known chromosome:Sscrofa10.2:7:26716751:26731477:1 gene:ENSSSCG00000001342 transcript:ENSSSCT00000035776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETSLLEAGASAASTAAALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDL
ERDFPCPVCRKTSRYRSLRPNRQLGSMVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYE
DQEAVCLICAISHTHRAHTVVPLDDATQEYKEKLQKCLEPLEQKLQEITRCKSSEEKKPG
ELKRLVESRRQQILKEFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKRRDL
AHLAAEVEGKCLQSGFEMLKDVKSTLEKCEKVKTMEVTSVSIELEKNFSNFPRQYFALRK
ILKQLIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTS
GRHYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLH
IKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFYPGIRAGRKNAAPLT
IRPPTDWE
Download sequence
Identical sequences I7FTT9
ENSSSCP00000001416 ENSSSCP00000029869 ENSSSCP00000030828 NP_001121951.1.46622 XP_005653512.1.46622 XP_013852039.1.46622 9823.ENSSSCP00000001416 ENSSSCP00000001416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]