SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030948 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030948
Domain Number 1 Region: 12-219
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.36e-63
Family Carbonic anhydrase 0.0000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030948   Gene: ENSSSCG00000023169   Transcript: ENSSSCT00000034744
Sequence length 247
Comment pep:novel chromosome:Sscrofa10.2:12:28270031:28376185:-1 gene:ENSSSCG00000023169 transcript:ENSSSCT00000034744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XALFDMFSIALQVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQ
GSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLN
RDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITR
MQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYR
VNEWLLK
Download sequence
Identical sequences ENSSSCP00000030948 ENSSSCP00000030948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]