SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030986 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030986
Domain Number 1 Region: 36-193
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 2.43e-53
Family Phosphoglycerate kinase 0.000000228
Further Details:      
 
Domain Number 2 Region: 1-31
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 0.000002
Family Phosphoglycerate kinase 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030986   Gene: ENSSSCG00000012440   Transcript: ENSSSCT00000036102
Sequence length 193
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:71340588:71351768:-1 gene:ENSSSCG00000012440 transcript:ENSSSCT00000036102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIKAAIPSIKFCLDNGAKSVVLMSHLGRPDGIPMPDKYSLEPVAVELKSLLGKDVLFLKD
CVGPEVEKACADPAAGSVILLENLRFHVEEEGKGKDASGSKGLDCGPESSKKYSEAVARA
KQIVWNGPVGVFEWEAFAQGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSH
VSTGGGASLELLE
Download sequence
Identical sequences ENSSSCP00000030986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]