SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000031029 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000031029
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.4e-20
Family Autophagin-like 0.00000872
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000031029   Gene: ENSSSCG00000012569   Transcript: ENSSSCT00000035950
Sequence length 110
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:103044907:103054567:1 gene:ENSSSCG00000012569 transcript:ENSSSCT00000035950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKSKLLADISARLWFTYRRKFSPIDWNWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMEK
MCCASALSADAAVESRRDSLNASTQSKGPSACRPAWKPLLLIVPLRLGIN
Download sequence
Identical sequences ENSSSCP00000031029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]