SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000187 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000187
Domain Number 1 Region: 35-147
Classification Level Classification E-value
Superfamily FKBP-like 3.54e-37
Family FKBP immunophilin/proline isomerase 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000187   Gene: ENSSSCG00000000180   Transcript: ENSSSCT00000000189
Sequence length 201
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:15369112:15373235:-1 gene:ENSSSCG00000000180 transcript:ENSSSCT00000000189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRPSFLPLRLLLLLLLSGAMCRAEAGFETESPVRTLQVETLVEPPEPCAEPAAFGDTL
HIHYSGSLVDGRIFDTSLSRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRVIIPSHLAYG
KRGFPPSIPADAELHFDVELIALIRANYWQKLVKGILPLVGMAMVPALLGLIGYHLYKKA
SRPKVSKKKLKEEKRNKSKKK
Download sequence
Identical sequences 9823.ENSSSCP00000000187 ENSSSCP00000000187 ENSSSCP00000000187 XP_003126145.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]