SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000622 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000622
Domain Number 1 Region: 865-1214
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.92e-94
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000868
Further Details:      
 
Domain Number 2 Region: 688-861
Classification Level Classification E-value
Superfamily ARM repeat 3.7e-46
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00054
Further Details:      
 
Domain Number 3 Region: 1231-1351
Classification Level Classification E-value
Superfamily PX domain 5.23e-19
Family PX domain 0.0041
Further Details:      
 
Domain Number 4 Region: 534-669
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.37e-18
Family PLC-like (P variant) 0.035
Further Details:      
 
Domain Number 5 Region: 1377-1483
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000827
Family Synaptotagmin-like (S variant) 0.015
Further Details:      
 
Domain Number 6 Region: 235-354
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000186
Family Ras-binding domain, RBD 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000622   Gene: ENSSSCG00000000591   Transcript: ENSSSCT00000000636
Sequence length 1486
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:57747752:58107859:-1 gene:ENSSSCG00000000591 transcript:ENSSSCT00000000636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYCWKTDRDSSESHEKQQEHHESHSVNQPLFPSQVSLGFDHIVDEISNKVPLYQREIEK
NTIFVPSASSWDSRRHSLDETHQISLNEFISRSSELSCHQGSKTPVIGFSHSVLPDSQRK
KKESSWGNPTENYHGADDSRFDILAPPSSGLDKTNSRSELENENHNYHIGFESSIPLIYP
TSSNDSMPKEENKRRRNMNIVEPSLMIFKGSLLPRTWESTCPKNIEPTGCTIQLVEVPQG
SNMSLASFCDKVKKIRETYHADDINSNSGKIWSTTTAFPYRLFPNTKFNISIFTDNSTQQ
LHFMPYANYLVKDLIAEILHLCTNDQLSSKDHLLSICGYEEFLQNDQYLGSHRIFQKNKS
VLQLTLQKNREAPGKLSRKHADDHSQFYLNQLLQFMHIWKVSRQCLSTVIKKYDFHLRYL
LKTQQNMDNMIEEVKNICGVLGCVETKQITDAINELNLILQRKAESFHQNSETSTKGLIE
KVTTKLSMSIYQLIDIYCCSFYADFQPLNAPNSVSCVNLGLHSHLSFTVYAAHNIPETWV
HSYKAFSFSCWLTYAGKKLCQVRNYRNIPVKKLLFFLVNWNETINFPLEIKALPRESMLT
IKLFGVTCATNSADLLAWTCFPLFPKQRYILRSVLFSTTLQDEPPLEMIAPGVWDISQPS
PVTLQINFPATEWEYMKLDSQENRSDLEEPPKECLKHISRLSQKQSPLLLSEEKRRYLWF
YRFYCNNENCSLPLVLGSAPGWDEKTVSEMHAILRRWKFSHPLDALGLLTSSFPDQEIRK
VAVQQLDKLLNDELLEYLPQLVQAVKFEWNLESPLVQLLLHRSLQSIQIAHRLYWLLKDA
QNEAYFKSWYQKLLAALQFCVGKALSDEFSKEKKLIKILGDIGEKVKSASDPQRQEVLKK
EIGRLEEFFQGSDTCHLPLNPAVCIKGIDGNACSYFTSNALPLKITFINANPMGRNISVI
FKAGDDLRQDMLVLQIIQVMDNIWLQEGLDMQMIIYRCLSTGKGQGLVQMVPDAVTLAKI
HRHSGLIGPLKENTIKKWFSQHNHLKVDYEQALRNFFYSCAGWCVVTFILGVCDRHNDNI
MLTKSGHMFHIDFGKFLGHAQTFGGIKRDRAPFIFTSEMEYFITEGGKNPQHFQDFVELC
CRAYNIVRRHSRLLLNLLEMMLHAGLPELSGIQDLKYVYDNLRPQDSDLEATSHFTKKIK
ESLECFPVKLNNLIHTLAQMTAISPAKSTSQTFSQESCMLSATRSIQKATILGFSKKTNH
LYLIQVTHSKNETILTEKSFDQFSKLHSQLQKQFVSWTLPEFPHWWHLPFTNSDHKRFRD
LNHYMEQILNGSYEVANSDCVLSFFLSDPVEQAVEELSPVDLGEKFPDKKPKVQLVISYE
DAKLTILVKHMKNIHLPDGSVPSAHVEFYLLPYPSEVRRRKTKSVPKCTNPTYNEIVVYD
EVTELQGHVLMLIVKSKTTFVGAINIRLCSVLLNEEKWYPLGNNII
Download sequence
Identical sequences F1SQY9
ENSSSCP00000000622 XP_020947948.1.46622 XP_020947949.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]