SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000656 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000656
Domain Number 1 Region: 489-744
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 188-427
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-49
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 3 Region: 792-1051
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-39
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 4 Region: 5-134
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-28
Family YWTD domain 0.0000367
Further Details:      
 
Domain Number 5 Region: 746-793
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000576
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 444-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 7 Region: 1104-1142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 1182-1220
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000128
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 9 Region: 1144-1180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 138-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000464
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1061-1114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000493
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000656   Gene: ENSSSCG00000000625   Transcript: ENSSSCT00000000671
Sequence length 1470
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:63577474:63674469:1 gene:ENSSSCG00000000625 transcript:ENSSSCT00000000671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFRFMYWTDWGEVPKIERAGMDGSSRFIIINTEIYWPNGLTLDYEERKLYWADAKLNFI
HKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKYTGEGLREIHSNIF
SPMDIHAFSQQRQPNETTNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKD
VLGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRA
IRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISE
DLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGK
IYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSA
EREIIIDQLPDLMGLKATNVHRIIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISD
MKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISL
KTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLV
WKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKR
RLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSG
QNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLN
ADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWID
SRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRL
DGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSK
PIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQ
QQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGD
GTTRCSCPMHLVLLQDELLCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDEL
NCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHK
KCDHNLDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRMLCPRMK
GDGETMTNDYVVHGPASVPLGYVPHPGSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRA
HVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYR
HFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEEN
YESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences ENSSSCP00000000656 ENSSSCP00000000656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]