SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001003 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001003
Domain Number 1 Region: 89-183
Classification Level Classification E-value
Superfamily PDZ domain-like 9.6e-30
Family PDZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 10-66
Classification Level Classification E-value
Superfamily L27 domain 5.1e-22
Family L27 domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001003   Gene: ENSSSCG00000000938   Transcript: ENSSSCT00000001025
Sequence length 220
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:105477330:105610293:1 gene:ENSSSCG00000000938 transcript:ENSSSCT00000001025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMH
ETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIY
ISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVL
EEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQTQQNHMS
Download sequence
Identical sequences H0WQA3
ENSSSCP00000001003 ENSOGAP00000004120 ENSOGAP00000004120 ENSSSCP00000001003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]