SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001635 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001635
Domain Number 1 Region: 90-524
Classification Level Classification E-value
Superfamily Ras GEF 1.2e-88
Family Ras GEF 0.00011
Further Details:      
 
Domain Number 2 Region: 644-732
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.03e-33
Family Ras-binding domain, RBD 0.0000082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001635   Gene: ENSSSCG00000001506   Transcript: ENSSSCT00000001679
Sequence length 771
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:34159507:34166143:-1 gene:ENSSSCG00000001506 transcript:ENSSSCT00000001679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRPLRLLWDTSPPGGVVLSSFRSRDPEEGGGPGGRGVGGGQEEEEEEEEDEAPVSAWN
EEEDGATFTVTSRQYQPPDPLAPRPPPRFSRRLRAGTLEALVRHLLDAGTSGADVTFTAA
FLATHRAFTSTPAVLGLVADRLEALESRPPDELERTKGVAISVLSTWLASHPEDFGSEVK
GQLDRLESFLLQTGYAAGEGVGGGGADLIRNLRSRVDPQPPDLPKPLALPGDPPADPTDV
LVFLADHLAEQLTLLDAELFLNLVPSQCLGALWGHRDRPGHAHLCPSVRATVTQFNRVAG
AVVSSVLGATSTGEGPGEVTVRPLRPPQRARLLEKWIRVAEECRLLRNFSSVYAVVSALQ
SSPVHRLRAAWGEAARDSLRVFSNLCQIFSEEDNYSQSRELLLQEGKLQPSLEPTSKKSP
RSGSRGGGVVPYLGTFLKDLVMLDAASKDELENGYINFDKRRKEFAVLSELRRLQNECRG
YDLRPDPEIQRWLQGLRPLTEAQSHRVSCEVEPLGTGDPPAPRVLRPTLVISQWTEVLGS
VGGPTPLVSWDRPSVGADEAAGTPAPLLTRLAQHMKWPSVSSLDSALDGTPTLQSPVNPS
HLSPPTSSPKPSRGHRRSASCGSPLSGGADGASRGAGCGSGPGASDCRIIRVQMELGEDG
SVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELVQLLPGERELTIPASANVFYAMD
GASHDFLLRQRRRPSTATLGPSASGTPPSAGGGGSFPRIKATGRKIARALF
Download sequence
Identical sequences 9823.ENSSSCP00000001635 ENSSSCP00000001635 ENSSSCP00000001635 NP_001171822.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]