SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001689 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001689
Domain Number 1 Region: 545-576,718-792
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001689   Gene: ENSSSCG00000001555   Transcript: ENSSSCT00000001733
Sequence length 938
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:36660474:36714021:-1 gene:ENSSSCG00000001555 transcript:ENSSSCT00000001733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHPERSYQGFGSRYRQNSFTYDVKRDVYNEETFHQEHRRKSASSGNVDINITTFSHHVH
CRCSWHKFRRCMLTVFPFLEWMCLYRFKDWLLGDLLAGINVGLVQIPQGLTFSLLARQLV
PPLNVSYSAFCSSVIYVIFGSCHQMSIGSFFLVSALAINVLRMYPFNSGRLILGTFIKDD
FSDISFFAKYNRSLSVVASTTFLTGIIQLSMGLFGFGFIVTYLPEAAISAYLAATALHIM
LSQLTCIFGIMISFHSGPISFFYNIINYCLDLPKANSTSILLFLTSVVAMRINKCIRISF
NQYPIEFPMEIFLILGFTAIANKINMATENSKMLIDMMPYSFLFPETPDFSILTEVLLEA
FSLALVSASLLVFLGKKIASFHNYEVNSNQDLIAIGLCNVASSFFRSYVFTGAIIRTIIQ
DKCGGRQQFASLVSAGVMLLLMLKVGRFFYQLPNAVLAGIILSVLPYLETMYNLPTLWKR
NQGCMIIWVVTFTSAVALGLDVGLLVAVAFTFFIITVQSHRTKILLLGQIPNTNIYRSIH
DYREVTNIPGVKIFQCCNAITFVNVYYLKRKLLEEVEMVMVPLSEEEMYRLFNNEEGSQR
GKMCRCFCNCDEVEPPPRFIYTERYESKWDRNSSSINLIRCSRLESVDTSQSTSDDQAPY
VMSSTSQRNNNYEEVEKAWPSGDPSRSISTLPEVSESQLRERTLLPYSSMSLLPPPPLPP
QIHTIILDFSMVHLVDAHASVVLRQMCNAFQNINLLVLIAGCHSSVVRTFEKNDFFDSGI
SKAQLFLTLHDAVLFALSRKLPDSSELSVDESETVIQETYSETEKNGESRHKMKSSLTGI
PRNKTSGFAAQQDPVTEESELDMDLYPTLESQQETGLDLDLGLDHQMEPESELEPETEPE
PETETETEPESRPRAQAYPRQQYWPLYQPPSSRSPPQT
Download sequence
Identical sequences 9823.ENSSSCP00000001689 ENSSSCP00000001689 ENSSSCP00000001689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]