SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003307 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003307
Domain Number 1 Region: 74-130
Classification Level Classification E-value
Superfamily Kringle-like 6e-18
Family Fibronectin type II module 0.0017
Further Details:      
 
Domain Number 2 Region: 42-86
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000999
Family Fibronectin type II module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003307   Gene: ENSSSCG00000003053   Transcript: ENSSSCT00000003390
Sequence length 130
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:46138657:46140689:1 gene:ENSSSCG00000003053 transcript:ENSSSCT00000003390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRLGIFLLWAGVSVFLPLDPVNGDQHLPGRFLTPAITSDDKCVFPFIYKGNLYFDCTL
HDSTYYWCSVTTYYMKRWRYCRSTDYARCALPFIFRGKEYDSCIKEGSVFSKYWCPVTPN
YDQDRAWRYC
Download sequence
Identical sequences P80964
ENSSSCP00000003307 NP_998997.1.46622 ENSSSCP00000003307 9823.ENSSSCP00000003307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]