SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003330 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003330
Domain Number 1 Region: 417-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-25
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 641-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.92e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 696-753
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 529-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 809-865
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.62e-24
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 8 Region: 753-809
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.52e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-21
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 10 Region: 305-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.01e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 11 Region: 854-906
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 12 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-18
Family KRAB domain (Kruppel-associated box) 0.00096
Further Details:      
 
Domain Number 13 Region: 249-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000123
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000003330
Domain Number - Region: 208-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000179
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003330   Gene: ENSSSCG00000003076   Transcript: ENSSSCT00000003413
Sequence length 908
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:46653582:46680733:1 gene:ENSSSCG00000003076 transcript:ENSSSCT00000003413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAVTFKDVAVAFTEEELGLLDSAQRKLYQEVMVENFRNLVSVGHQPFKRDTSLSLPQKEK
KFNKEVNGISDGGENSQNQSELRAIQDRGSHEELSCWQIWQQIADDLTRCQDSMINSCQF
HKLTGDSPCQVGAGLSIHISGDENCILSEKMNGPSGIENPEFATLGVQNSWRKTSLTESQ
NYHYRHKPISMKNKLYQCKEDFENINWISHHLDGHREHKSENSYNHDDYGKDSIRLSAFQ
NSMIHTEQKPYQCDKCKKTFTSLSTFGLHEQLHSKEKTHMCSECGKGFCYSSVLHIHQRV
HMKEFTQSSHLQTHQKVHTIKKPFKCEECGKGFSRRSALSVHCKVHTGEKPYTCEECGRA
FSQASHLQDHHRVHTGEKPFKCDACGKSFSRNSHLQSHQRVHTGEKPYKCEECGRGFICS
SNLYIHQRVHTGEKPYKCEECGKGFSRPSSLQAHQGIHTGEKPYKCDECGKSFRRNSHYQ
VHLVVHTGEKPYKCEVCGKGFSQSSYLQIHQKAHSIEKPYKCEECGQGFNQSSRLQIHQL
IHTGEKPYKCEDCGKGFSRRADLKIHCRIHTGEKPYNCEECGKVFRQASNLLAHQRVHSG
EKPFKCEECGKSFGRSSHLQAHQKVHTGEKPYKCEECGKGFKWSLNLDMHQRVHTGEKPY
KCGECGKHFSQASSLQLHQSVHTGEKPYRCDVCGKVFSRSSQLQSHQRVHTGEKPYKCEA
CGKGFTQAAHYHIHQRVHTGEKPYKCDVCGKGFSHNSPLICHRRVHTGEKPYRCEACGKG
FTRNTDLHIHFRVHTGEKPYKCKECGKGFSQASNLQVHQNVHTGEKRFKCETCGKGFSQS
SKLQTHQRVHTGEKPYRCDVCGKDFSYSSNLKLHQVIHTGEKPYKCEECGKGFSWRSNLH
AHQRVHSG
Download sequence
Identical sequences ENSSSCP00000003330 ENSSSCP00000003330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]