SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003424 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003424
Domain Number 1 Region: 88-182
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-30
Family PDZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 9-63
Classification Level Classification E-value
Superfamily L27 domain 2.79e-23
Family L27 domain 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003424   Gene: ENSSSCG00000003157   Transcript: ENSSSCT00000003507
Sequence length 207
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:50015309:50018862:-1 gene:ENSSSCG00000003157 transcript:ENSSSCT00000003507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDT
LDITGSAEVRAHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYIS
RVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPRVLEE
MEARFEKMRSARRRQQHQSYSSLESRG
Download sequence
Identical sequences F1RIN6
NP_001231161.1.46622 ENSSSCP00000003424 ENSSSCP00000003424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]