SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004039 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004039
Domain Number 1 Region: 66-257
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.76e-51
Family Astacin 0.0000918
Further Details:      
 
Domain Number 2 Region: 428-593
Classification Level Classification E-value
Superfamily TRAF domain-like 5.89e-32
Family MATH domain 0.0013
Further Details:      
 
Domain Number 3 Region: 265-428
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-29
Family MAM domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000004039
Domain Number - Region: 607-647
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000409
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004039   Gene: ENSSSCG00000003732   Transcript: ENSSSCT00000004132
Sequence length 702
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:108695979:108727131:1 gene:ENSSSCG00000003732 transcript:ENSSSCT00000004132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSWYLPSFLFVAALLLVSGLPAPENFDVDGGLDRDIFDINEDLGLDLFEGDISLDGVQE
RNSIVGEGYRWPHTIPYVLDDSLEMNARGVILEAFERYRLKTCIDFKPWSGEANYISVFK
GSGCWSSVGNQHVGKQNLSIGHNCDRTATVQHEFLHALGFFHEQSRSDRDDYVSIIWDRI
TPGSKENNFKAYTDEETDSLNVPYDYNSVMHYSKTAFQIGSEPTIVTRISDFMDVIGQRL
DFSDHDLLKLNRLYNCSSSLSFMDSCDFELENVCGMIQSSEDSADWQRVSQVPEGPESDH
SNMGQCKGSGFFMHFSSSSVNVGDTAVLESRKLYPKRGFQCLQFFLYNSGHENDQLDIYI
REYSGDNVNGILILVEEIKDIPLGSWQLYHVTLKVTNKFRVVFRGVRGAGDSLGGLSIDD
INLSETQCPHHTWHIRNFTQYLSDPNGALFSPPFYSSKGYAFQIYMTLTNLTKIGIYFHL
ISGANDDQLQWPCPWQQATMTILDQNPDIRQRMSNGRSITTDPSLTSDDGTYFWDRPSKV
GTEAFFPNGTQFKRSRGYGSSSFITYERLKSRDFIKGNDVYILLTVEDISHLNSTQDEPV
PTSSVSDLCAFFRCENDGICLVRNGNAECRCPSGEDWWYMGKRCEKRGSRRDTIVIATSS
TAAVFALMLVITLVSVYCTRKKYRKEPGSHTANTTLENLVKF
Download sequence
Identical sequences ENSSSCP00000004039 ENSSSCP00000004039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]