SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004341 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004341
Domain Number 1 Region: 100-208
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-31
Family Second domain of FERM 0.0022
Further Details:      
 
Domain Number 2 Region: 6-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000248
Family First domain of FERM 0.012
Further Details:      
 
Domain Number 3 Region: 209-318
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000249
Family Third domain of FERM 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004341   Gene: ENSSSCG00000004017   Transcript: ENSSSCT00000004442
Sequence length 483
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:2657897:2672308:1 gene:ENSSSCG00000004017 transcript:ENSSSCT00000004442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEHRDVLVLLPTRERLRLVVGVQATGRELFQQVCDLASIREAQLFGLSVVRNNEYVFM
DLEQKLSKYFSKDWKREKHKGRGRPGAPFVAFLGVQFYVENGRVISDRTARHLYYCHLKE
RVLRSQCAHREEAYFLLAAYALQADLGNHREQAHAGRYFEPQAYFPPWVIARRGSAYILR
HVPALHREQRGLSPKEAALRFIREACRLEDVPTHFFRLRKDKKEEQPTIVLGLTLRGVQV
FQGKKFEIWPDGLPSARKLVYYAGGAWRPGPLLHLLRASHQLHLSLQPALQQLRQLEEAE
EKKCYRESYVSDEPELDRDPDLASRTSLGSPGGSGGDSGGGRPCPQRLWRLSAGSHCSSL
SSGIAVDSQPGETSVDEPPCSSSSSQSSRGSIGGGRAAPQQPAAVVRTTLLSTRDRSPEA
AHQGPEAVARHEDQHSRSLDDGHPTPAPRPKPRSCPLGRALDPGSRRSMNSLTLDLLPEE
FVV
Download sequence
Identical sequences 9823.ENSSSCP00000004341 ENSSSCP00000004341 ENSSSCP00000004341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]