SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004342 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004342
Domain Number 1 Region: 247-347
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-28
Family Ras-binding domain, RBD 0.00000247
Further Details:      
 
Domain Number 2 Region: 38-139
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.48e-23
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 997-1096
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-22
Family PDZ domain 0.0000282
Further Details:      
 
Domain Number 4 Region: 404-502
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.14e-19
Family FHA domain 0.00000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004342   Gene: ENSSSCG00000004018   Transcript: ENSSSCT00000004443
Sequence length 1798
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:2720188:2815404:-1 gene:ENSSSCG00000004018 transcript:ENSSSCT00000004443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFRESLRKLLSPIMQENSPWASSLGTMPLDSSLDDLEFHGVMRFYFQDKAAGNFATKCIR
VSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERRLDIDEKPLVVQLNWNKD
DREGRFVLKNENDAAPPKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKREKEAMRQA
SDKDDRPFHGEDTENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSS
DGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARV
MLPPGAQHSDEKGAKEIILDDDECPLQIFREWPGDKGMLVFQLKRRPPEHIPKKSKKHAE
GKPPKGKERPDGSGYGSALPPEKLPYLVELSPGRRGHFAYYSYHPHEDGSDSRDKPKLYR
LQLSVTEVGTEKFDDSSIQLFGSGIQPHHCDLTNMDGVVTVTPRSVDAETYVEGQRISET
TMLQSGVKVQFGASHVFKFVDPSQDHALAKRPGDGGLAVKGPRHKPGIVQETAFDLGGDV
HGGTAVASSKGSARPDGDRAPSASSSAERGMVKPMVRMEPPQEPRRQDTRPQDAAGPELT
LPASIEFRESAEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRHVLSSQYRPDVSPAERT
HKVIAIVNKMVSMMDGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLA
HLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIEDVLHTLTGAMSLLRRCRVNA
ALTIQLFSQLFHFINMWLFNRLLTDPESGLCSHYWGAIVRQQLGHVEAWAEKQGLELAAD
CHLSRVVQATTLLTMDKYAPEDAAGINSTCFKLNSLQLQALLHNYHCAPDEPLVPPDLIE
SVVAVAENTADELARSDGREVRLEEDPDLQLPFLLPEDGYSCDVVRNIPNGLQEFLDPLC
QRGFCRLTPQPRSPGSWTIHFEGAEYESRLARESTELAQPLRKEPEVITVTLKKQNGMGL
SIVAAKGAGQDKLGIYVKSVVRGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTR
TSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRISDRRGSGKPRPKSEGFELYNNSAQNGS
PESPPLPWAEYSEPKKLPGDERLTKNRADHRSSPNVANQPPSPGGKGAHAAGTAAKITSV
STGNLCTEEQTPPPGTEAYPIPTQAYPREYFTFPASRSQDRVVPPQSQWPSYEEKPHADS
SHSSLAVQQRVTRSQEELREDAGAYPLHRMEAVMDRKSDSDMWVAQSSSMGSSASSQEHL
DPSSKAGTPASTLTKSGPGRWKTPAVLQPAPGPQPLRTDLPTHYAGDVDGVPVDLPLPPP
PAAAGQGLAGGQGAAERKKREEQQRWYEKEKARLEEERERKRREQERKLGQMRSQALLPA
PLSPGATKPAAPGPQDTVIRELQPQQQPRTIERRDLQYITVSREELSAGDSLSPDPWKRD
AREKLEKQQQMHVVDLLSREIHELQSKAERSAEESGRLRKLMLEWQFQKRLQESKQKDED
DDEEEDDDVDTMLIMQRLEAERRARLQDEERRRQQQLEEMRQREAEERARHEEERRRQEE
ERLKREAEEKRRQEEGYYSRLEAERRRQHEEAERRLLEPEEPGLGRPPLPRGYEPPGPAP
PPPPQRAASYLQAQVLSPDSLYTAKFVAYDDDDEEEDGPAGKGPASYMGSTGTLMGAHDG
SRDPRETLSKSQDADVPGGPESLTFRERQRLFSQGHEVSSKVKASRRLTELENELNTK
Download sequence
Identical sequences ENSSSCP00000004342 ENSSSCP00000004342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]