SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004364 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004364
Domain Number 1 Region: 564-808
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.92e-81
Family Eukaryotic proteases 0.0000000741
Further Details:      
 
Domain Number 2 Region: 367-466
Classification Level Classification E-value
Superfamily Kringle-like 1.22e-38
Family Kringle modules 0.0000139
Further Details:      
 
Domain Number 3 Region: 273-362
Classification Level Classification E-value
Superfamily Kringle-like 7.01e-37
Family Kringle modules 0.0000171
Further Details:      
 
Domain Number 4 Region: 90-183
Classification Level Classification E-value
Superfamily Kringle-like 7.66e-37
Family Kringle modules 0.0000314
Further Details:      
 
Domain Number 5 Region: 183-267
Classification Level Classification E-value
Superfamily Kringle-like 5.11e-34
Family Kringle modules 0.0000105
Further Details:      
 
Domain Number 6 Region: 475-561
Classification Level Classification E-value
Superfamily Kringle-like 3.73e-33
Family Kringle modules 0.00000972
Further Details:      
 
Domain Number 7 Region: 19-100
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.24e-21
Family Hairpin loop containing domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004364   Gene: ENSSSCG00000004038   Transcript: ENSSSCT00000004466
Sequence length 809
Comment pep:novel chromosome:Sscrofa10.2:1:8739981:8787582:1 gene:ENSSSCG00000004038 transcript:ENSSSCT00000004466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHKEVVLLLLLFLKSGLGDSLDDYVNTQGAFLFSLSRKQVAARSVEECAAKCEAETNFI
CRAFQYHSKDQQCVVMAENSKTSPIARMRDVVLFEKRIYLSECKTGNGKNYRGTTSKTKS
GVICQKWSVSSPHIPKYSPEKFPLAGLEENYCRNPDNDEKGPWCYTTDPETRFDYCDIPE
CEDECMHCSGEHYEGKISKTMSGIECQSWGSQSPHAHGYLPSKFPNKNLKMNYCRNPDGE
PRPWCFTTDPNKRWEFCDIPRCTTPPPTSGPTYQCLKGRGENYRGTVSVTASGHTCQRWS
AQSPHKHNRTPENFPCKNLEENYCRNPDGETAPWCYTTDSEVRWDYCKIPSCGSSTTSTE
YLDAPVPPEQTPVAQDCYRGNGESYRGTSSTTITGRKCQSWVSMTPHRHEKTPGNFPNAG
LTMNYCRNPDADKSPWCYTTDPRVRWEYCNLKKCSETEQQVTNFPAIAQVPSVEDLSEDC
MFGNGKRYRGKRATTVAGVPCQEWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDDNGP
WCYTTNPQKLFDYCDVPQCVTSSFDCGKPKVEPKKCPARVVGGCVSIPHSWPWQISLRHR
YRGHFCGGTLISPEWVLTAKHCLEKSSSPSSYKVILGAHEEHHLGEGVQEIDVSKLFKEP
SGADIALLKLSSPAIITDKVIPACLPTPNYVVADRTACYITGWGETKGTYGAGLLKEARL
PVIENKVCNRYEYLDGKVSSKELCAGHLAGGIDSCQGDSGGPLVCFEKDKYILQGVTSWG
LGCALPNKPGVYVRVSRFVTWIEEIMRRN
Download sequence
Identical sequences 9823.ENSSSCP00000004364 ENSSSCP00000004364 ENSSSCP00000004364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]