SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006147 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006147
Domain Number 1 Region: 8-151,241-547
Classification Level Classification E-value
Superfamily Ras GEF 5.75e-123
Family Ras GEF 0.00017
Further Details:      
 
Domain Number 2 Region: 662-756
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.07e-42
Family Ras-binding domain, RBD 0.0000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006147   Gene: ENSSSCG00000005738   Transcript: ENSSSCT00000006309
Sequence length 787
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:306700486:306714090:1 gene:ENSSSCG00000005738 transcript:ENSSSCT00000006309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CENESALNLYETCKVRTVKAGTLEKLVGHLVPAFQGSDLSYVTVFLCTYRAFTTTQQVLD
LLFERYGCILPYAHEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQL
NMPGSDLERRAHLLLAQLEHAELTQAEPEGKAGLSLNSSPLAALKPAPELELAPAPLLAP
SPVPAPDLEPVPGPDLEPALAPAPDPEPAPAPAPTPELELALSQSLELEPASAPEPSWPS
PVAAEKGLGEEKPHLLAFPAVLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDKKGKEHLA
PTVRATVTQFNNVANCVITTCLGDRSVTARGRARVVEHWIQVARECRALKNFSSLYAILS
ALQSNSIHRLKKTWDEVSRESFRIFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNP
KRAQKRPKETGVIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKL
LQSACNNYSIAPEEQFRAWFQAMEWLSETESYNLSCELEPPSESASNTLRVKKNAAIVKR
WSDRQAPSTELSASSSCHSKSCDQLRCSPYLSSGDIADALSVHSAGSSSSDVEEINVSFV
PESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVATARTHKRSVSGVCSHGS
SLPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLDEDEPEDYE
LVQVISEDRKLKIPDNANVFYAMNSTANYDFVLKKRTFTKGAKVRHGASSTLPRMKQKGL
KIAKGIF
Download sequence
Identical sequences ENSSSCP00000006147 ENSSSCP00000006147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]